Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [4]
- Immunocytochemistry [5]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91019 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91019, RRID:AB_2665765
- Product name
- Anti-HSP90B1
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
SGNMERIMKAQAYQTGKDISTNYYASQKKTFEINP
RHPLIRDMLRRIKEDEDDKTVLDLAVVLFETATLR
SGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEP
EEEPEETAEDTTEDTEQDEDEEMDVGTDEEEETAK
ESTA- Epitope
- Binds to an epitope located within the peptide sequence EEEPEETAED as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL2647
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-HSP90B1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line U-251
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line HeLa, human cell line HEK 293, human cell line A-431 and human cell line HepG2.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis of extracts from U-251 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-HSP90B1 monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-PPIB monoclonal antibody was used as loading control.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining in HeLa cell line with Anti-HSP90B1 monoclonal antibody, showing specific staining of endoplasmic reticulum in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining in A431 cell line with Anti-HSP90B1 monoclonal antibody, showing specific staining of endoplasmic reticulum in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining in MCF7 cell line with Anti-HSP90B1 monoclonal antibody, showing specific staining of endoplasmic reticulum in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining in U2OS cell line with Anti-HSP90B1 monoclonal antibody, showing specific staining of endoplasmic reticulum in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining in U251 cell line with Anti-HSP90B1 monoclonal antibody, showing specific staining of endoplasmic reticulum in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong cytoplasmic immunoreactivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cortex shows strong cytoplasmic positivity in neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong cytoplasmic immunoreactivity in glandular and lymphoid cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.