HPA003901

HSP90B1 antibody from Atlas Antibodies
GP96, GRP94, TRA1
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA003901
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003901, RRID:AB_1234537
Product name
Anti-HSP90B1
Provider product page
Atlas Antibodies - HPA003901
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SGNMERIMKAQAYQTGKDISTNYYASQKKTFEINP
RHPLIRDMLRRIKEDEDDKTVLDLAVVLFETATLR
SGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEP
EEEPEETAEDTTEDTEQDEDEEMDVGTDEEEETAK
ESTA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -