HPA008424

HSP90B1 antibody from Atlas Antibodies
GP96, GRP94, TRA1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008424
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008424, RRID:AB_1851184
Product name
Anti-HSP90B1
Provider product page
Atlas Antibodies - HPA008424
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
WSSKTETVEEPMEEEEAAKEEKEESDDEAAVEEEE
EEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVE
EDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSI
LFVPTS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -