HPA003901

HSP90B1 antibody from Sigma-Aldrich
GP96, GRP94, TRA1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003901
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003901, RRID:AB_1851181
Product name
Anti-HSP90B1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003901
Antibody type
Polyclonal
Antigen
Endoplasmin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGNMERIMKAQAYQTGKDISTNYYASQKKTFEINP
RHPLIRDMLRRIKEDEDDKTVLDLAVVLFETATLR
SGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEP
EEEPEETAEDTTEDTEQDEDEEMDVGTDEEEETAK
ESTA
Storage
-20C
Provider Type Product Number
- No reagents -