H00003489-A01

IGFBP6 antibody from Abnova Corporation
No application information provided.

Antibody data

Product number
H00003489-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003489-A01, RRID:AB_461675
Product name
IGFBP6 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00003489-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length recombinant IGFBP6.
Antigen sequence
MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQG
VQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQE
CGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCL
PARAPAVAEENPKESKPQAGTARPQDVNRRDQQRN
PGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQ
TEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRG
PCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -