HPA008005

IGFBP6 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008005
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008005, RRID:AB_1851499
Product name
Anti-IGFBP6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008005
Antibody type
Polyclonal
Antigen
Insulin-like growth factor-binding protein 6 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAE
ENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQ
PNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQT
LYVPNCDHRGFYRKRQCRSSQGQRRGPCWC
Storage
-20C
Provider Type Product Number
- No reagents -