HPA023886

MYO1E antibody from Atlas Antibodies
HuncM-IC, MGC104638, MYO1C
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023886
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023886, RRID:AB_1854253
Product name
Anti-MYO1E
Provider product page
Atlas Antibodies - HPA023886
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VIRNQYVPYPHAPGSQRSNQKSLYTSMARPPLPRQ
QSTSSDRVSQTPESLDFLKVPDQGAAGVRRQTTSR
PPPAGGRPKPQPKPKPQVPQCKALYAYDAQDTDEL
SFNANDIIDIIKEDPSGWWTGRLRGKQG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -