HPA023886

MYO1E antibody from Sigma-Aldrich
HuncM-IC, MGC104638, MYO1C
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023886
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023886, RRID:AB_1854253
Product name
Anti-MYO1E antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023886
Antibody type
Polyclonal
Antigen
Myosin-Ie recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VIRNQYVPYPHAPGSQRSNQKSLYTSMARPPLPRQ
QSTSSDRVSQTPESLDFLKVPDQGAAGVRRQTTSR
PPPAGGRPKPQPKPKPQVPQCKALYAYDAQDTDEL
SFNANDIIDIIKEDPSGWWTGRLRGKQG
Storage
-20C
Provider Type Product Number
- No reagents -