HPA021808

MYH3 antibody from Sigma-Aldrich
HEMHC, MYHC-EMB, MYHSE1, SMHCE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021808
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021808, RRID:AB_1854242
Product name
Anti-MYH3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021808
Antibody type
Polyclonal
Antigen
Myosin-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGK
VTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAML
Storage
-20C
Provider Type Product Number
- No reagents -