HPA016845

PTPN23 antibody from Sigma-Aldrich
DKFZP564F0923, HD-PTP, KIAA1471
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016845
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016845, RRID:AB_1855926
Product name
Anti-PTPN23 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016845
Antibody type
Polyclonal
Antigen
Tyrosine-protein phosphatase non-receptor type 23 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLDQFMDSMQLDPETVDNLDAYSHIPPQLMEKCAA
LSVRPDTVRNLVQSMQVLSGVFTDVEASLKDIRDL
LEEDELLEQKFQEAVGQAGAISITSKAELAEVRRE
WAKYMEVHEKASFTNSELHRAMNLHVGN
Storage
-20C
Provider Type Product Number
- No reagents -