HPA008275

GAS6 antibody from Sigma-Aldrich
AXLLG, AXSF, DKFZp666G247, FLJ34709
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008275
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008275, RRID:AB_1849497
Product name
Anti-GAS6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008275
Antibody type
Polyclonal
Antigen
Growth arrest-specific protein 6 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
STWEVEVVAHIRPAADTGVLFALWAPDLRAVPLSV
ALVDYHSTKKLKKQLVVLAVEHTALALMEIKVCDG
QEHVVTVSLRDGEATLEVDGTRGQSEVSAAQLQER
LAVLERHLRSPVLTFAGGLPDVPVTS
Storage
-20C
Provider Type Product Number
- No reagents -