Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 101-M67 - Provider product page

- Provider
- ReliaTech GmbH
- Product name
- PlGF
- Antibody type
- Monoclonal
- Antigen
- Recombinant human PlGF-2
- Description
- antibody purified from hybridoma supernatant
- Reactivity
- Human
- Host
- Mouse
- Antigen sequence
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCR
ALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCG
DENLHCVPVETANVTMQLLKIRSGDRPSYVELTFS
QHVRCECRPLREKMKPERRRPKGRGKRRREKQRPT
DCHLCGDAVPRR- Isotype
- IgG
- Antibody clone number
- (#178/G10)
- Vial size
- 100 µl
- Storage
- Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
- Handling
- Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- Western analysis of human and mouse PlGF-2 with a monoclonal antibody directed against human PlGF-2 derived from insect cells. There is no cross reactivity with mouse PlGF.
- Sample type
- Purified recombinant proteins
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- PlGF Sandwich-ELISA using recombinant human PlGF-1 as standard [Cat# 300-015]. Mouse anti-human PlGF #178/G10 (Cat# 101-M67) was used as capture antibody, Biotinylated rabbit anti-human PlGF (Cat# 102-PABi04) was used for detection.
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- Recombinant human PlGF-1 derived from insect cells was first precipitated using the monoclonal anti-human PlGF #178/G10. Western analysis was performed using a polyclonal antibody against human PlGF.
- Sample type
- Purified recombinant proteins