102-PA04S
antibody from ReliaTech GmbH
Targeting: PGF
D12S1900, PGFL, PIGF, PLGF, PlGF-2, SHGC-10760
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 102-PA04S - Provider product page
- Provider
- ReliaTech GmbH
- Product name
- PlGF (native)
- Antibody type
- Polyclonal
- Antigen
- Recombinant human PlGF-2
- Description
- antibody Protein-A purified from serum
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCR
ALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCG
DENLHCVPVETANVTMQLLKIRSGDRPSYVELTFS
QHVRCECRPLREKMKPERRRPKGRGKRRREKQRPT
DCHLCGDAVPRR- Antibody clone number
- Rabbit IG
- Vial size
- 100 µl
- Storage
- Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
- Handling
- Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Western analysis of human PlGF-2 with a polyclonal antibody directed against human PlGF-2 derived from insect cells.
- Sample type
- Purified recombinant proteins