Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 101-M65 - Provider product page
- Provider
- ReliaTech GmbH
- Product name
- PlGF-2
- Antibody type
- Monoclonal
- Antigen
- Recombinant human PlGF-2
- Description
- antibody purified from hybridoma supernatant
- Reactivity
- Human
- Host
- Mouse
- Antigen sequence
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCR
ALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCG
DENLHCVPVETANVTMQLLKIRSGDRPSYVELTFS
QHVRCECRPLREKMKPERRRPKGRGKRRREKQRPT
DCHLCGDAVPRR- Isotype
- IgG
- Antibody clone number
- (#3B10)
- Vial size
- 100 µl
- Storage
- Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
- Handling
- Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Western analysis with human PlGF-1 and PlGF-2 derived from insect cells. The monoclonal antibody #3B10 recognizes solely the PlGF-2 isofoem.
- Sample type
- Purified recombinant proteins
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- IHC with cryo sections of human placenta. The experiment was performed by PD. Dr. Jörg Wilting, Pädiatrie I, Zentrum für Kinderheilkunde und Jugendmedizin in Göttingen, Germany.
- Sample type
- Human placenta tissue
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- IHC with cryo sections of human placenta. Note, that the syncytiothroblast layer is positiv for PlGF but not other fetal cells insite the trophoblast villi. The experiment was performed by PD. Dr. Jörg Wilting, Pädiatrie I, Zentrum für Kinderheilkunde und Jugendmedizin in Göttingen, Germany.
- Sample type
- Human placenta tissue