H00006935-M01
antibody from Abnova Corporation
Targeting: ZEB1
AREB6, BZP, FECD6, NIL-2-A, PPCD3, TCF8, ZEB, Zfhep, Zfhx1a
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006935-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006935-M01, RRID:AB_622396
- Product name
- ZEB1 monoclonal antibody (M01), clone 4C4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ZEB1.
- Antigen sequence
NIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQT
ILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDER
QDTSSEGVSNVEDQNDSDSTPPKKKMRKTE- Isotype
- IgG
- Antibody clone number
- 4C4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The cytokine IL-6 reactivates breast stromal fibroblasts through transcription factor STAT3-dependent up-regulation of the RNA-binding protein AUF1.
Hendrayani SF, Al-Khalaf HH, Aboussekhra A
The Journal of biological chemistry 2014 Nov 7;289(45):30962-76
The Journal of biological chemistry 2014 Nov 7;289(45):30962-76
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ZEB1 is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ZEB1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- U-2 OS cells were stained with ZEB1-FITC labeled monoclonal antibody (Green). The cell nucleus were counterstained with DAPI (Blue).
- Validation comment
- Immunofluorescence (Circulating Tumor Cell)