Antibody data

Product number
H00000902-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000902-M01, RRID:AB_463877
Product name
CCNH monoclonal antibody (M01), clone 1B8
Provider product page
Abnova Corporation - H00000902-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CCNH.
Antigen sequence
MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAV
ANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSV
FKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIM
LTCAF
Isotype
IgG
Antibody clone number
1B8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -