HPA003915

ITPR3 antibody from Sigma-Aldrich
IP3R3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003915
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003915, RRID:AB_1851845
Product name
Anti-ITPR3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003915
Antibody type
Polyclonal
Antigen
Inositol 1,4,5-trisphosphate receptor type 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ITSTKNEKIFQESIGLAIHLLDGGNTEIQKSFHNL
MMSDKKSERFFKVLHDRMKRAQQETKSTVAVNMND
LGSQPHEDREPVDPTTKGRVASFSIPGSSSRYSLG
PSLRRGHEVSERVQSSEMGTSVLIMQPILRFLQLL
CENHNRD
Storage
-20C
Provider Type Product Number
- No reagents -