HPA017941

ELMO1 antibody from Sigma-Aldrich
CED-12, CED12, ELMO-1, KIAA0281
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017941
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017941, RRID:AB_1848128
Product name
Anti-ELMO1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017941
Antibody type
Polyclonal
Antigen
Engulfment and cell motility protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QTLDTPSLRTVTLTVRVHGFILEVSKTKNPPIPDT
FWPPRWDHRPSPGGETNAYCQMNHVNPAMDFTQTP
PGMLALDNMLYFAKH
Storage
-20C
Provider Type Product Number
- No reagents -