PAB21610

ADPRM antibody from Abnova Corporation
C17orf48, MDS006

Antibody data

Product number
PAB21610
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21610, RRID:AB_10968560
Product name
C17orf48 polyclonal antibody
Provider product page
Abnova Corporation - PAB21610
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant C17orf48.
Antigen sequence
ALAVIWSHECVVCFFAGHTHDGGYSEDPFGVYHVN
LEGVIETAPDSQAFGTVHVYPDKMMLKGRGRVPDR
IMNYKKERAFHC
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -