HPA023265

ADPRM antibody from Sigma-Aldrich
C17orf48, MDS006
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023265
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023265, RRID:AB_1845590
Product name
Anti-C17orf48 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023265
Antibody type
Polyclonal
Antigen
Magnesium-dependent ADP-ribose/CDP-alcohol diphosphatase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QSSPKYEQCMKILREHNPNTELNSPQGLSEPQFVQ
FNGGFSQEQLNWLNEVLTFSDTNQEKVVIVSHLPI
YP
Storage
-20C
Provider Type Product Number
- No reagents -