Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00130497-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00130497-M04, RRID:AB_626484
- Product name
- OSR1 monoclonal antibody (M04), clone 3F3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant OSR1.
- Antigen sequence
MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPS
DHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFS
KVPGTVSSLVDARFQLPAFPWFPHVIQPKP- Isotype
- IgG
- Antibody clone number
- 3F3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The generation of kidney organoids by differentiation of human pluripotent cells to ureteric bud progenitor-like cells.
Directed differentiation of human pluripotent cells to ureteric bud kidney progenitor-like cells.
SPAK-knockout mice manifest Gitelman syndrome and impaired vasoconstriction.
Xia Y, Sancho-Martinez I, Nivet E, Rodriguez Esteban C, Campistol JM, Izpisua Belmonte JC
Nature protocols 2014 Nov;9(11):2693-704
Nature protocols 2014 Nov;9(11):2693-704
Directed differentiation of human pluripotent cells to ureteric bud kidney progenitor-like cells.
Xia Y, Nivet E, Sancho-Martinez I, Gallegos T, Suzuki K, Okamura D, Wu MZ, Dubova I, Esteban CR, Montserrat N, Campistol JM, Izpisua Belmonte JC
Nature cell biology 2013 Dec;15(12):1507-15
Nature cell biology 2013 Dec;15(12):1507-15
SPAK-knockout mice manifest Gitelman syndrome and impaired vasoconstriction.
Yang SS, Lo YF, Wu CC, Lin SW, Yeh CJ, Chu P, Sytwu HK, Uchida S, Sasaki S, Lin SH
Journal of the American Society of Nephrology : JASN 2010 Nov;21(11):1868-77
Journal of the American Society of Nephrology : JASN 2010 Nov;21(11):1868-77
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged OSR1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to OSR1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to OSR1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol