Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00130497-M10 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00130497-M10, RRID:AB_530153
- Product name
- OSR1 monoclonal antibody (M10), clone 1G9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant OSR1.
- Antigen sequence
MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPS
DHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFS
KVPGTVSSLVDARFQLPAFPWFPHVIQPKP- Isotype
- IgG
- Antibody clone number
- 1G9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references WNK4 is the major WNK positively regulating NCC in the mouse kidney.
Takahashi D, Mori T, Nomura N, Khan MZ, Araki Y, Zeniya M, Sohara E, Rai T, Sasaki S, Uchida S
Bioscience reports 2014 May 9;34(3)
Bioscience reports 2014 May 9;34(3)
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged OSR1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol