HPA015525

OSR1 antibody from Sigma-Aldrich
ODD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015525
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015525, RRID:AB_1854822
Product name
Anti-OSR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015525
Antibody type
Polyclonal
Antigen
Protein odd-skipped-related 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPR
SSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKPE
ITAGGSVPALKTKPRFDFANLALAATQEDPAKLGR
GEGPGSPAGGLGALLDVTKLSPEKKPTR
Storage
-20C
Provider Type Product Number
- No reagents -