HPA020639

DNAH9 antibody from Sigma-Aldrich
DNAH17L, Dnahc9, DNAL1, DYH9, HL-20, HL20, KIAA0357
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020639
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020639, RRID:AB_1847912
Product name
Anti-DNAH9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020639
Antibody type
Polyclonal
Antigen
Dynein heavy chain 9, axonemal recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVARDTSDKYLVLIQMFNKDLDAVRMIYSQHVQEE
AELGFSPVHKNMPTVAGGLRWAQELRQRIQGPFSN
FGRITHPCMESAEGKRMQQKYEDMLSLL
Storage
-20C
Provider Type Product Number
- No reagents -