HPA005856

TP53INP1 antibody from Sigma-Aldrich
DKFZp434M1317, FLJ22139, P53DINP1, SIP, Teap, TP53INP1A, TP53INP1B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005856
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005856, RRID:AB_10600832
Product name
Anti-TP53INP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005856
Antibody type
Polyclonal
Antigen
tumor protein p53 inducible nuclear protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQ
WIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGW
VVHQPC
Storage
-20C
Provider Type Product Number
- No reagents -