HPA024198

C8orf37 antibody from Sigma-Aldrich
BBS21, CORD16, FLJ30600, RP64
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024198
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024198, RRID:AB_1845775
Product name
Anti-C8orf37 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024198
Antibody type
Polyclonal
Antigen
Uncharacterized protein C8orf37 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAEDLDELLDEVESKFCTPDLLRRGMVEQPKGCGG
GTHSSDRNQAKAKETLRSTETFKKEDDLDSLINE
Storage
-20C
Provider Type Product Number
- No reagents -