HPA003982

PKN1 antibody from Sigma-Aldrich
DBK, MGC46204, PAK1, PKN, PRK1, PRKCL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003982
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003982, RRID:AB_1855440
Product name
Anti-PKN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003982
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase N1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QKLGLLREALERRLGELPADHPKGRLLREELAAAS
SAAFSTRLAGPFPATHYSTLCKPAPLTGTLEVRVV
GCRDLPETIPWNPTPSMGGPGTPDSRPPFLSRPAR
GLYSRSGSLSGRSSLKAEAENTSEVS
Storage
-20C
Provider Type Product Number
- No reagents -