HPA018126

CAPRIN1 antibody from Sigma-Aldrich
caprin-1, GPIAP1, M11S1, RNG105
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018126
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018126, RRID:AB_1849929
Product name
Anti-CAPRIN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018126
Antibody type
Polyclonal
Antigen
Caprin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LWDLLEGKEKPVCGTTYKVLKEIVERVFQSNYFDS
THNHQNGLCEEEEAASAPAVEDQVPEAEPEPAEEY
TEQSEVESTEYVNRQFMAETQFTSGEKEQVDEWTV
ETVEVVNSLQQQPQAASPSVPEPHSLTPVAQ
Storage
-20C
Provider Type Product Number
- No reagents -