HPA025762

ACOT7 antibody from Atlas Antibodies
ACH1, ACT, BACH, CTE-II, hBACH, LACH1, MGC1126
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA025762
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA025762, RRID:AB_1844524
Product name
Anti-ACOT7
Provider product page
Atlas Antibodies - HPA025762
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NKSMEIEVLVDADPVVDSSQKRYRAASAFFTYVSL
SQEGRSLPVPQLVPETEDEKKRFEEGKGRYLQMKA
KRQGH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -