HPA025762

ACOT7 antibody from Sigma-Aldrich
ACH1, ACT, BACH, CTE-II, hBACH, LACH1, MGC1126
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025762
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025762, RRID:AB_1844524
Product name
Anti-ACOT7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025762
Antibody type
Polyclonal
Antigen
Cytosolic acyl coenzyme A thioester hydrolase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NKSMEIEVLVDADPVVDSSQKRYRAASAFFTYVSL
SQEGRSLPVPQLVPETEDEKKRFEEGKGRYLQMKA
KRQGH
Storage
-20C
Provider Type Product Number
- No reagents -