HPA003894

BIN1 antibody from Atlas Antibodies
AMPH2, AMPHL, SH3P9
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003894
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003894, RRID:AB_1233554
Product name
Anti-BIN1
Provider product page
Atlas Antibodies - HPA003894
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFM
FKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEE
QDEGWLMGVKESDWNQHKELEKCRGVFPENFTERV
P
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -