HPA007235

MUC1 antibody from Sigma-Aldrich
ADMCKD, ADMCKD1, CD227, MCD, MCKD, MCKD1, PEM, PUM
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007235
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007235, RRID:AB_1846281
Product name
Anti-MUC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007235
Antibody type
Polyclonal
Antigen
mucin 1 isoform 5 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTD
YYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSV
VVQLTLAFREGTINVHDVETQFNQYKTEAASRYNL
TISDVSVSDVPFPFSAQSGAGV
Storage
-20C
Provider Type Product Number
- No reagents -