HPA023235

CPQ antibody from Sigma-Aldrich
LDP, PGCP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023235
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023235, RRID:AB_1855257
Product name
Anti-AP003117.2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023235
Antibody type
Polyclonal
Antigen
Plasma glutamate carboxypeptidase Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YERLALLVDTVGPRLSGSKNLEKAIQIMYQNLQQD
GLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAIL
GLGSSIGTPPE
Storage
-20C
Provider Type Product Number
- No reagents -