HPA020065

ABTB2 antibody from Atlas Antibodies
ABTB2A, BTBD22, DKFZP586C1619
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020065
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020065, RRID:AB_1844459
Product name
Anti-ABTB2
Provider product page
Atlas Antibodies - HPA020065
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IPTTDILELLSAASLFQLDALQRHCEILCSQTLSM
ESAVNTYKYAKIHNAPELALFCEGFFLKHMKALLE
QDA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -