HPA020065

ABTB2 antibody from Sigma-Aldrich
ABTB2A, BTBD22, DKFZP586C1619
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020065
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020065, RRID:AB_1844459
Product name
Anti-ABTB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020065
Antibody type
Polyclonal
Antigen
Ankyrin repeat and BTB/POZ domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IPTTDILELLSAASLFQLDALQRHCEILCSQTLSM
ESAVNTYKYAKIHNAPELALFCEGFFLKHMKALLE
QDA
Storage
-20C
Provider Type Product Number
- No reagents -