H00023369-M07

PUM2 antibody from Abnova Corporation
KIAA0235, PUMH2
No application information provided.

Antibody data

Product number
H00023369-M07
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023369-M07, RRID:AB_1204880
Product name
PUM2 monoclonal antibody (M07), clone 1E10
Provider product page
Abnova Corporation - H00023369-M07
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PUM2.
Antigen sequence
KLDSRFRKGNFGTRDAETDGPEKGDQKGKASPFEE
DQNRDLKQGDDDDSKINGRGLPNGMDADCKDFNRT
PGSRQASPTEVVERLGPNTNPSEGLGPLPN
Isotype
IgG
Antibody clone number
1E10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -