HPA000817

AMN antibody from Sigma-Aldrich
amnionless
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000817
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000817, RRID:AB_1078146
Product name
Anti-AMN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000817
Antibody type
Polyclonal
Antigen
Amnionless protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADK
MVSVLVQEGHAVSDMLLPLDGELVLASGAGFGVSD
VGSHLDCGAGEPAVFRDSDRFSWHDPHLWRSGDEA
PGLFFVDAERVPCRHDDVFFPPSASFRVGLGPGAS
PVRVRSISAL
Storage
-20C
Provider Type Product Number
- No reagents -