HPA002873

ABHD12B antibody from Atlas Antibodies
BEM46L3, C14orf29
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002873
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002873, RRID:AB_611918
Product name
Anti-ABHD12B
Provider product page
Atlas Antibodies - HPA002873
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVA
SINYPLLKIYRNIPGFLRTLMDALRKDKIVFPNDE
NVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNA
YRNKERVKMVIFPPGFQHNLLCKSPTLLITVRDFL
SKQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -