HPA002873

ABHD12B antibody from Sigma-Aldrich
BEM46L3, C14orf29
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002873
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002873, RRID:AB_2220573
Product name
Anti-ABHD12B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002873
Antibody type
Polyclonal
Antigen
Uncharacterized protein C14orf29 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVA
SINYPLLKIYRNIPGFLRTLMDALRKDKIVFPNDE
NVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNA
YRNKERVKMVIFPPGFQHNLLCKSPTLLITVRDFL
SKQ
Storage
-20C
Provider Type Product Number
- No reagents -