HPA009654

THRA antibody from Atlas Antibodies
AR7, EAR-7.1/EAR-7.2, ERBA, ERBA1, NR1A1, THRA1, THRA2, THRA3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009654
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009654, RRID:AB_1854603
Product name
Anti-THRA
Provider product page
Atlas Antibodies - HPA009654
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AFEHYVNHRKHNIPHFWPKLLMKEREVQSSILYKG
AAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLE
QQLGEAGSLQGPVLQHQSPKSPQQRLLELLHRSGI
LHARAVCGEDDSSE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -