HPA009654

THRA antibody from Sigma-Aldrich
AR7, EAR-7.1/EAR-7.2, ERBA, ERBA1, NR1A1, THRA1, THRA2, THRA3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009654
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009654, RRID:AB_1854603
Product name
Anti-THRA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009654
Antibody type
Polyclonal
Antigen
Thyroid hormone receptor alpha recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AFEHYVNHRKHNIPHFWPKLLMKEREVQSSILYKG
AAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLE
QQLGEAGSLQGPVLQHQSPKSPQQRLLELLHRSGI
LHARAVCGEDDSSE
Storage
-20C
Provider Type Product Number
- No reagents -