Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011279-M12 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011279-M12, RRID:AB_1204581
- Product name
- KLF8 monoclonal antibody (M12), clone 3F10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant KLF8.
- Antigen sequence
MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNR
DPPEIEYRSNMTSPTLLDANPMENPALFNDIKIEP
PEELLASDFSLPQVEPVDLSFHKPKAPL- Isotype
- IgG
- Antibody clone number
- 3F10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of KLF8 expression in transfected 293T cell line by KLF8 monoclonal antibody (M12), clone 3F10.Lane 1: KLF8 transfected lysate(39.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged KLF8 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol