Antibody data

Product number
H00011279-M12
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00011279-M12, RRID:AB_1204581
Product name
KLF8 monoclonal antibody (M12), clone 3F10
Provider product page
Abnova Corporation - H00011279-M12
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant KLF8.
Antigen sequence
MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNR
DPPEIEYRSNMTSPTLLDANPMENPALFNDIKIEP
PEELLASDFSLPQVEPVDLSFHKPKAPL
Isotype
IgG
Antibody clone number
3F10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -