H00022907-B01

DHX30 antibody from Abnova Corporation
DDX30, FLJ11214, KIAA0890

Antibody data

Product number
H00022907-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00022907-B01, RRID:AB_1573855
Product name
DHX30 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00022907-B01
Antibody type
Polyclonal
Antigen
DHX30 (AAH14237.1, 1 a.a. ~ 501 a.a) full-length human protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MHESKYLILPVHSNIPMMDQKAIFQQPPVGVRKIV
LATNIAETSITINDIVHVVDSGLHKEERYDLKTKV
SCLETVWVSRANVIQRRGRAGRCQSGFAYHLFPRS
RLEKMVPFQVPEILRTPLENLVLQAKIHMPEKTAV
EFLSKAVDSPNIKAVDEAVILLQEIGVLDQREYLT
TLGQRLAHISTDPRLAKAIVLAAIFRCLHPLLVVV
SCLTRDPFSSSLQNRAEVDKVKALLSHDSGSDHLA
FVRAVAGWEEVLRWQDRSSRENYLEENLLYAPSLR
FIHGLIKQFSENIYEAFLVGKPSDCTLASAQCNEY
SEEEELVKGVLMAGLYPNLIQVRQGKVTRQGKFKP
NSVTYRTKSGNILLHKSTINREATRLRSRWLTYFM
AVKSNGSVFVRDSSQVHPLAVLLLTDGDVHIRDDG
RRATISLSDSDLLRLEGDSRTVWLLKELRRALGRM
VERSLRSELAALPPSVQEEHGQLLALLAELLRGPC
GSFDVRKTADD
Vial size
50 μl
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -