HPA004148

TAF10 antibody from Sigma-Aldrich
TAF2A, TAF2H, TAFII30
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004148
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004148, RRID:AB_1857736
Product name
Anti-TAF10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004148
Antibody type
Polyclonal
Antigen
Transcription initiation factor TFIID subunit 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYT
PTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKF
ISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTM
EDLTPALSEYGINVKKP
Storage
-20C
Provider Type Product Number
- No reagents -