H00414328-M10

IDNK antibody from Abnova Corporation
bA522I20.2, C9orf103, hGntK

Antibody data

Product number
H00414328-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00414328-M10, RRID:AB_1137115
Product name
C9orf103 monoclonal antibody (M10), clone 3B7
Provider product page
Abnova Corporation - H00414328-M10
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant C9orf103.
Antigen sequence
KKTYRDILTQGKDGVALKCEESGKEAKQAEMQLLV
VHLSGSFEVISGRLLKREGHFMPPELLQSQFETLE
PPAAPENFIQISVDKNVSEIIATIMETLKMK
Isotype
IgG
Antibody clone number
3B7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -