HPA020378

IDNK antibody from MilliporeSigma / Merck KGaA
bA522I20.2, C9orf103, hGntK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020378
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA020378, RRID:AB_1845794
Product name
Anti-C9orf103 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA020378
Antibody type
Polyclonal
Antigen
Probable gluconokinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLVMGVSGSGKSTVGALLASELGWKFYDADDYHPE
ENRRKMGKGIPLNDQDRIPWLCNLHDILLRDVASG
QRVVLACSALKKTYR
Storage
-20C
Provider Type Product Number
- No reagents -