HPA025070

ERICH5 antibody from Atlas Antibodies
C8orf47, FLJ39553
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA025070
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA025070, RRID:AB_1845778
Product name
Anti-ERICH5
Provider product page
Atlas Antibodies - HPA025070
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QPQGTVGKDEQAPLLETISKENESPEILEGSQFVE
TAEEQQLQATLGKEEQPQLLERIPKENVTPEVLDR
SQLVEK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -