PAB21762

ERICH5 antibody from Abnova Corporation
C8orf47, FLJ39553

Antibody data

Product number
PAB21762
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21762, RRID:AB_10967762
Product name
C8orf47 polyclonal antibody
Provider product page
Abnova Corporation - PAB21762
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant C8orf47.
Antigen sequence
QPQGTVGKDEQAPLLETISKENESPEILEGSQFVE
TAEEQQLQATLGKEEQPQLLERIPKENVTPEVLDR
SQLVEK
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -