HPA025293

ERICH5 antibody from Sigma-Aldrich
C8orf47, FLJ39553
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025293
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025293, RRID:AB_1845779
Product name
Anti-C8orf47 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025293
Antibody type
Polyclonal
Antigen
Uncharacterized protein C8orf47 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FHKTPEGPGNMEQIQPEGIVGSMEHPARNVEAGAY
VEMIRNIHTNEEDQRIEGETGEKVETDMENEKVSE
GAETKEEETGEVV
Storage
-20C
Provider Type Product Number
- No reagents -