HPA022856

RIDA antibody from Atlas Antibodies
HRSP12, P14.5, PSP, UK114
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022856
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022856, RRID:AB_1858253
Product name
Anti-RIDA
Provider product page
Atlas Antibodies - HPA022856
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISG
QIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -